Git Product home page Git Product logo

betabarrellstm's Introduction

BetaBarrelLSTM

Generation of Beta Barrel Protein Sequences with an LSTM recurrent neural network.

This script uses Deep Learning Neural Networks (LSTM) with Keras on TensorFlow, to generate new beta barrel protein sequences. This script generates FASTA sequences.

Example of a generated beta barrel FASTA sequence:

GVEFDEETVDGRKVKSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVMKGVTSTRVYERACPTLGGVGNQTTVDNGPDNSGGGDNVNGVAVGFVVVVPGGGTVGSTVGGGVISGVGGVTVDVTTIRVNIVVGRSVGTVVVDTTTVGTTIDSGDTNTVDGDDGTVTKAGGVRVDVVNFVGVGEGVNVPSLLVDKNVVIVRGTDGVNPGVRSYDG
EGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKECDAFVGTWKLVSSENFDDYMKEGDKVGGVVNTDVDVVGDATTDVVGDSGRVGNPRRTVVVGGTGVYAYVGSVVQSDGPVSKTDDVGDGGTVDRTSGVGPVDRGTDTDSGGVNAPPGVLTQKQ 
TVDITVTYEDGSTATGQLTVDSPTQFKFDMTASDGTRFTGTVQRQSMSRAAQLLPGTWQVTMTNEDGQTGVGGVTDVAIVVGVRDDIVTGTGVGDRNTTSSGDGLVVDVDGDVFGTDGGVRGVTSVVNVVSKRGDTNDGAVTTVVNGTEDGVDDDDTVVSNVVVRVV

How To Install and Use:

Clone the directory:

git clone https://github.com/JesslynJanssen/BetaBarrelLSTM

Then, install all requirements:

sudo apt update && sudo apt full-upgrade && sudo apt install python3-pip python3-pandas python3-numpy python3-tensorflow tensorboard && pip3 install keras

Finally, train the model or generate new beta barrel protein sequences.

Training the Model

Beta barrel FASTA sequence data from the Protein Data Bank is already provided, but you can train the model with other beta barrel proteins or any other type of protein.

To train the network yourself, run the following command:

python3 train betabarrel

Generate Beta Barrel Sequences

To generate new beta barrel FASTA sequences, run the following command:

python3 generate betabarrel 

To determine whether the generated sequences may be plausible, do a BLAST and PSIPRED run to align with database protein sequences.

betabarrellstm's People

Contributors

jesslynjanssen avatar

Watchers

 avatar

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.