Comments (2)
Hello, it looks like you are trying to pass in too much of the antibody sequence. Specifically, here it looks like your sequence is ~240 residues, so I would guess it is the variable fragment plus the first conserved domain.
For IgFold, the expected input is just the variable fragment. If I truncated the sequence to
QMKLMQSGGVMVRPGESATLSCVASGFDFSRNGFEWLRQGPGKGLQWLATVTFESKTHVTASARGRFTISRDNSRRTVYLQMTNLQPDDTAMYFCVKDQTIFHKNGAVDFFSYFDLWGRGAPVIVS
it looks reasonable.
from igfold.
Thank you for your answer, it is indeed done in this way. I also want to ask you a question, is igfold can be used to predict the structure of antigens? Do you have any suggestions for this
from igfold.
Related Issues (20)
- colab notebook ModuleNotFoundError HOT 2
- Chain breaks after Rosetta refinement HOT 1
- ValueError: min() arg is an empty sequence HOT 1
- Doubts on the usage of PDB templates
- it seems a bug in save_PDB HOT 1
- predict the structure using one single seq: H + linker + V HOT 2
- IgFold Colab HOT 1
- Commercial license HOT 2
- sequence-level embedding
- How to assign a different GPU? HOT 1
- Corrupt structures HOT 2
- Where are pretrained models HOT 1
- Circular import errors HOT 1
- Documentation improvements
- ValueError: min() arg is an empty sequence HOT 4
- TypeError: Unit "kilocalorie/mole" is not compatible with Unit "kilojoule/(nanometer*mole)".
- Predicted structuers not available (wget failed: ... connection refused); also "https://data.graylab.jhu.edu" unreachable HOT 1
- IgFold Colab
- torch version
Recommend Projects
-
React
A declarative, efficient, and flexible JavaScript library for building user interfaces.
-
Vue.js
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
-
Typescript
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
-
TensorFlow
An Open Source Machine Learning Framework for Everyone
-
Django
The Web framework for perfectionists with deadlines.
-
Laravel
A PHP framework for web artisans
-
D3
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
-
Recommend Topics
-
javascript
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
-
web
Some thing interesting about web. New door for the world.
-
server
A server is a program made to process requests and deliver data to clients.
-
Machine learning
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
-
Visualization
Some thing interesting about visualization, use data art
-
Game
Some thing interesting about game, make everyone happy.
Recommend Org
-
Facebook
We are working to build community through open source technology. NB: members must have two-factor auth.
-
Microsoft
Open source projects and samples from Microsoft.
-
Google
Google ❤️ Open Source for everyone.
-
Alibaba
Alibaba Open Source for everyone
-
D3
Data-Driven Documents codes.
-
Tencent
China tencent open source team.
from igfold.