abnumber.exceptions.ChainParseError: Found 2 antibody domains in sequence: about igfold HOT 2 CLOSED

Hello, it looks like you are trying to pass in too much of the antibody sequence. Specifically, here it looks like your sequence is ~240 residues, so I would guess it is the variable fragment plus the first conserved domain.

For IgFold, the expected input is just the variable fragment. If I truncated the sequence to
QMKLMQSGGVMVRPGESATLSCVASGFDFSRNGFEWLRQGPGKGLQWLATVTFESKTHVTASARGRFTISRDNSRRTVYLQMTNLQPDDTAMYFCVKDQTIFHKNGAVDFFSYFDLWGRGAPVIVS
it looks reasonable.

from igfold.

Thank you for your answer, it is indeed done in this way. I also want to ask you a question, is igfold can be used to predict the structure of antigens? Do you have any suggestions for this

from igfold.